PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012803.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 278aa    MW: 31149.9 Da    PI: 4.7147
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012803.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.3e-092212542255
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +yp+++++  LA+++gL++rq+ +WF N+R ++
  Aco012803.1 221 WPYPTEADKIALAESTGLDQRQINNWFINQRKRH 254
                  69*****************************885 PP

2ELK285.1e-10174195122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  +LK+ LlrKYsgy  sLkqEFs
  Aco012803.1 174 DLKDKLLRKYSGYFRSLKQEFS 195
                  69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.6E-2264108IPR005540KNOX1
PfamPF037901.3E-2066107IPR005540KNOX1
SMARTSM011882.2E-5174195IPR005539ELK domain
PROSITE profilePS5121310.284174194IPR005539ELK domain
PfamPF037892.1E-7174195IPR005539ELK domain
PROSITE profilePS5007112.779194257IPR001356Homeobox domain
SuperFamilySSF466893.08E-20195272IPR009057Homeodomain-like
SMARTSM003892.9E-13196261IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-28199258IPR009057Homeodomain-like
CDDcd000864.38E-11206258No hitNo description
PfamPF059206.7E-18214253IPR008422Homeobox KN domain
PROSITE patternPS000270232255IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEEEMMYGMM MQRAAADDLH GLIAAAGAGG GGGGFRSAAA ERDGGEGEEE EEEIMEEMEE  60
TAMGEVKARI ASHPRYPTLL RAYIDCQKVG APPEIASFLE EIRRENDAAA AARSAVSGRL  120
LPGADPELDE FMLSLFLNEI NEADEAAAGS LEEELSGGET QAHESSHLKN EYRDLKDKLL  180
RKYSGYFRSL KQEFSKKKKK GKLPKEARQK LLDWWTAHYK WPYPTEADKI ALAESTGLDQ  240
RQINNWFINQ RKRHWKPSES MQFAVMDSLS SPFYMND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006841054.16e-93PREDICTED: homeobox protein knotted-1-like 2
SwissprotQ84JS68e-81KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLE2ESJ81e-93E2ESJ8_AGATE; KNOX2
STRINGVIT_17s0000g08710.t012e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-66KNOTTED1-like homeobox gene 6